PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 308aa    MW: 34917.4 Da    PI: 9.9557
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45529.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-072873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     rWT++E +l+ +a + + ++   +W ++a+ ++ g+t  +++  ++ 
       KHN45529.1 28 RWTPQENKLFENALAVFDKDtpdRWLKVAALIP-GKTVGDVIKQYRE 73
                     9********************************.******9999986 PP

2Myb_DNA-binding43.95.7e-14136180347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       KHN45529.1 136 PWTKEEHRQFLTGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 180
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.9492479IPR017884SANT domain
SMARTSM007175.8E-82577IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-112782IPR009057Homeodomain-like
CDDcd001672.88E-62874No hitNo description
PfamPF002496.2E-62873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-12127185IPR009057Homeodomain-like
PROSITE profilePS5129421.257129185IPR017930Myb domain
SuperFamilySSF466896.75E-17130184IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-17132184IPR006447Myb domain, plants
SMARTSM007172.7E-13133183IPR001005SANT/Myb domain
PfamPF002492.8E-12136180IPR001005SANT/Myb domain
CDDcd001672.96E-11136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNRGIEVLSP ASYLQSSNWL FQESSGTRWT PQENKLFENA LAVFDKDTPD RWLKVAALIP  60
GKTVGDVIKQ YRELEADVSV IESGFIPVPG YTATDSFTLE WVNNQGFGGL RQFYGVTGKR  120
GASNRPSEQE RKKGVPWTKE EHRQFLTGLK KYGKGDWRNI SRNFVITRTP TQVASHAQKY  180
FIRQLSGGKD KKRSSIHDIT MVNLPEAKSL SSESNRPSSL DHSVKDVNPP RQNQKLSTTM  240
VIKQEHDWKL PCETVPMHFN STNRNMFMTQ LCGISSNGSK PLQEQYFLSG CQFGPYGTII  300
QMQSMQNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-162594776RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311840.0KT031184.1 Glycine max clone HN_CCL_88 MYB/HD-like transcription factor (Glyma03g14440.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516340.10.0PREDICTED: transcription factor DIVARICATA-like isoform X1
SwissprotQ8S9H71e-110DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2SM590.0A0A0B2SM59_GLYSO; Transcription factor MYB1R1
STRINGGLYMA01G27720.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-117MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]